معلومة

ما مدى صعوبة إعادة تكوين البروتين؟

ما مدى صعوبة إعادة تكوين البروتين؟


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

أعلم بتجارب Anfinsen وأدرك أن بعض الإنزيمات المشوهة قد تستعيد نشاطها المفقود من خلال إزالة العامل الممسخ. ما لا أعرفه هو مدى ندرة أن يتمكن البروتين من إعادة التكوين؟ هل تستطيع كل البروتينات أن تفعل ذلك؟ إذا لم يكن بإمكانهم جميعًا فعل ذلك ، فما مدى ندرة أو شيوع العثور على بروتين يمكن إعادة تكوينه؟

ملاحظة. لتجنب إجابات مثل "الاعتماد على عملية التمسخ" ، دعنا نفترض أنه يمكن إعادة تكوين البروتين إذا ثبت أنه يعاد تكوينه في إعداد تجريبي واحد على الأقل.


الجواب أشبه بـ "يعتمد على البروتين وعملية إعادة التشبع (أو إعادة الطي)". هناك الكثير من العوامل التي تساهم في قدرة البروتين الفردي على إعادة الطي ، بما في ذلك الحجم والتسلسل والبنية الثانوية وكمية ونوع روابط الأحماض الأمينية مثل روابط ثاني كبريتيد ، وعدد الوحدات الفرعية ، ووجود مرافقات / بروتينات الصدمة الحرارية ، ونعم ، كيف تم تغيير طبيعتها في المقام الأول (آسف ، لم أستطع المقاومة). ستُعاد طيّ البروتينات الأصغر بسهولة أكبر من البروتينات الأكبر حجمًا. تميل البروتينات المحبة للماء إلى الانتكاس بشكل أفضل من البروتينات الكارهة للماء ، خاصة البروتينات المرتبطة بالغشاء. تميل البروتينات / المجمعات متعددة الوحدات الفرعية إلى بعض المساعدة لإعادة التجميع بشكل صحيح. من شبه المؤكد أن إضافة البروتينات المرافقة / الصدمة الحرارية ستساعد العملية على طول جميع العينات باستثناء أصغرها وأصعبها ، وستعطيك نتائج أفضل من مجرد غسل جميع الأملاح / المنظفات / عوامل التشوتروبيك بعيدًا في برنامج تلفزيوني. أخيرًا ، إذا قمت بتغيير الطبيعة عن طريق الغليان في منطقة Laemmli العازلة ، فستواجه وقتًا صعبًا للغاية في إعادة طي معظم الأشياء ، في حين أن الانتقال من Guanidine HCl إلى PBS ليس دائمًا بهذا السوء ، اعتمادًا على ما تنظر إليه.

لذا ، لسوء الحظ ، الجواب هو "هذا يعتمد". عليك أن تتذكر أن البيئة داخل الخلايا معقدة للغاية ، وهي مصممة لطي البروتينات بشكل صحيح بعد تصنيعها ، وتفكيك البروتينات المشوهة قبل أن تتجمع أو تسبب أضرارًا أخرى. يوجد مئات الآلاف من البروتينات في البشر فقط ، لذلك من الصعب إصدار عبارات شاملة ، ولكن من أجل مقاومة التلف ، من المحتمل أن يتم إعادة تشكيل العديد من البروتينات الصغيرة أحادية الوحدة جزئيًا على الأقل واستعادة بعض أو كل نشاطهم الأصلي. ومع تزايد التعقيد ، تقل احتمالية استعادة الوظيفة بنجاح.


إذا كان البروتين عرضة لتغيرات في درجة الحرارة أو درجة الحموضة أو التعرض للمواد الكيميائية ، فيمكن تغيير التفاعلات الداخلية بين البروتين والأحماض الأمينية # 8217 ، مما قد يؤدي بدوره إلى تغيير شكل البروتين. على الرغم من أن تسلسل الأحماض الأمينية (المعروف أيضًا باسم البنية الأساسية للبروتين # 8217) لا يتغير ، إلا أن شكل البروتين # 8217 قد يتغير كثيرًا بحيث يصبح غير فعال ، وفي هذه الحالة يعتبر البروتين مشوهًا. البيبسين ، الإنزيم الذي يكسر البروتين في المعدة ، يعمل فقط عند درجة حموضة منخفضة للغاية. عند تشكّل البيبسين ودرجات الحموضة الأعلى ، تبدأ الطريقة التي يتم بها طي سلسلة البولي ببتيد في ثلاثة أبعاد في التغيير. تحافظ المعدة على درجة حموضة منخفضة جدًا لضمان استمرار البيبسين في هضم البروتين وعدم تغيير طبيعته.

نظرًا لأن جميع التفاعلات الكيميائية الحيوية تقريبًا تتطلب إنزيمات ، ولأن جميع الإنزيمات تقريبًا تعمل فقط على النحو الأمثل ضمن نطاقات درجة حرارة ودرجة حموضة ضيقة نسبيًا ، فإن العديد من آليات الاستتباب تنظم درجات الحرارة المناسبة ودرجة الحموضة بحيث يمكن للأنزيمات الحفاظ على شكل موقعها النشط.


نظرة عامة على تحلل الخلايا واستخراج البروتين

تحتوي جميع الخلايا على غشاء بلازما ، وهو طبقة ثنائية بروتين-دهون تشكل حاجزًا يفصل محتويات الخلية عن البيئة خارج الخلية. الدهون التي تتكون من غشاء البلازما هي amphipathic ، لها شقوق ماء وهايدروفوبي التي ترتبط تلقائيا لتشكيل ورقة ثنائية الجزيئية مغلقة. يتم تضمين بروتينات الغشاء في الطبقة الدهنية الثنائية ، ويتم تثبيتها في مكانها من خلال مجال واحد أو أكثر يمتد إلى النواة الكارهة للماء. بالإضافة إلى ذلك ، ترتبط البروتينات المحيطية بالسطح الداخلي أو الخارجي للطبقة الثنائية من خلال التفاعلات مع بروتينات الغشاء المتكامل أو مع مجموعات الرأس الدهنية القطبية. تختلف طبيعة محتوى البروتين والدهون باختلاف نوع الخلية وأنواع الكائن الحي.

هيكل غشاء الخلية. شكل توضيحي لطبقة دهنية ثنائية تشتمل على غشاء بلازما خارجي للخلية.

في الخلايا الحيوانية ، يعتبر غشاء البلازما هو الحاجز الوحيد الذي يفصل محتويات الخلية عن البيئة ، ولكن في النباتات والبكتيريا يكون غشاء البلازما محاطًا أيضًا بجدار خلوي صلب. تتكون جدران الخلايا البكتيرية من الببتيدوغليكان. تتكون جدران خلايا الخميرة من طبقتين من ß-glucan ، الطبقة الداخلية غير قابلة للذوبان في الظروف القلوية. كلاهما محاط بطبقة خارجية من البروتين السكري غنية بمانان الكربوهيدرات. تتكون جدران الخلايا النباتية من طبقات متعددة من السليلوز. تمنح هذه الأنواع من الحواجز خارج الخلية الشكل والصلابة للخلايا. تكون جدران الخلايا النباتية قوية بشكل خاص ، مما يجعل من الصعب جدًا تعطيلها ميكانيكيًا أو كيميائيًا. حتى وقت قريب ، كان التحلل الفعال لخلايا الخميرة يتطلب اضطرابًا ميكانيكيًا باستخدام حبيبات زجاجية ، في حين أن جدران الخلايا البكتيرية هي الأسهل في الكسر مقارنةً بأنواع الخلايا الأخرى. إن عدم وجود جدار خارج الخلية في الخلايا الحيوانية يجعلها سهلة نسبيًا.

لا يوجد بروتوكول عالمي لإعداد عينة البروتين. يجب أن تأخذ بروتوكولات تحضير العينة في الاعتبار عدة عوامل ، مثل مصدر العينة أو نوع العينة ، وعدم التجانس الكيميائي والهيكلية للبروتينات ، والموقع الخلوي أو دون الخلوي للبروتين محل الاهتمام ، وعائد البروتين المطلوب (الذي يعتمد على مجرى النهر) التطبيقات) ، والتطبيقات النهائية المقترحة. على سبيل المثال ، سوائل الجسم مثل البول أو البلازما هي بالفعل محاليل بروتينية متجانسة إلى حد ما مع نشاط إنزيمي منخفض ، ولا يلزم سوى معالجة طفيفة للحصول على البروتينات من هذه العينات. ومع ذلك ، تتطلب عينات الأنسجة معالجة مكثفة لتفكيك بنية الأنسجة ، والتحكم في النشاط الأنزيمي ، وإذابة البروتينات.

تعتبر الجودة أو الشكل المادي للبروتين المعزول أيضًا أحد الاعتبارات المهمة عند استخراج البروتينات لبعض التطبيقات النهائية. على سبيل المثال ، لا تتطلب التطبيقات مثل مقايسة الممتز المناعي المرتبط بالإنزيم (ELISA) أو علم البلورات بروتينات سليمة فحسب ، بل تتطلب أيضًا بروتينات نشطة وظيفيًا أو تحتفظ ببنيتها ثلاثية الأبعاد.

أمثلة على مصادر البروتين لجمع العينات. يمكن أن تأتي البروتينات من العديد من المصادر ، بما في ذلك ما يلي: المصادر الأصلية مثل مزارع خلايا الثدييات أو الأنسجة أو سوائل الجسم الإفراط في التعبير في نظام نموذجي مثل البكتيريا أو الخميرة أو الحشرات أو خلايا الثدييات الأجسام المضادة أحادية النسيلة من خلايا الورم الهجين أو الخلايا النباتية المستخدمة في التكنولوجيا الحيوية الزراعية .


تحليل Cryo-EM لبروتين غشائي مضمن في الجسيم الشحمي

اعتادت بروتينات الغشاء (MPs) أن تكون الأهداف الأكثر صعوبة للبيولوجيا الهيكلية عندما كان علم البلورات بالأشعة السينية هو النهج السائد. مع ثورة الدقة في الفحص المجهري الإلكتروني ذو الجسيم الواحد (cryo-EM) ، تم إحراز تقدم سريع للتوضيح الهيكلي لأعضاء البرلمان المعزولين. التحدي التالي هو الحفاظ على التدرجات الكهروكيميائية وانحناء الغشاء من أجل توضيح بنيوي شامل لأعضاء البرلمان الذين يعتمدون على هذه الخصائص الكيميائية والفيزيائية لوظائفهم البيولوجية. لتحقيق هذا الهدف ، نقدم هنا سير عمل مناسبًا للتحليل الهيكلي للـ cryo-EM للنواب المضمنين في الجسيمات الشحمية ، باستخدام AcrB المتميز جيدًا كنموذج أولي. من خلال الجمع بين عزل البروتينات الشحمية المحسّنة ، وإعداد العينة المبردة على شبكات الجرافين ، واستراتيجية اختيار الجسيمات الفعالة ، تم الحصول على إعادة الإعمار ثلاثي الأبعاد (3D) لـ AcrB المضمنة في الجسيمات الشحمية بدقة 3.9. يظل شكل AcrB المتماثل كما هو عندما تعرض الأغشية المحيطة انحناءات مختلفة. نهجنا ، الذي يمكن تطبيقه على نطاق واسع لتحليل البرودة الكهرومغناطيسية للنواب ذوي المجالات المميزة القابلة للذوبان ، يرسي الأساس لتحليل البرودة الكهرومغناطيسية لأعضاء البرلمان المتكامل أو المحيطي الذين تتأثر وظائفهم بالتدرجات الكهروكيميائية عبر الغشاء أو / وانحناءات الغشاء.

الكلمات الدالة: cryo-EM الجرافين شبكات غشاء بروتين البروتين البروتيني البيولوجيا الهيكلية.

بيان تضارب المصالح

يعلن المؤلفون أي مصلحة متنافسة.

الأرقام

تحسين تحضير عينات البروتين الشحمي البروتي ...

تعظيم الاستفادة من إعداد عينة تجميد البروتينات الشحمية. ( أ ) رسم تخطيطي للحجم ...

تصنيف ثنائي الأبعاد عميق للاختيار ...

تصنيف ثنائي الأبعاد عميق لاختيار جزيئات البروتين الجيدة المضمنة في الجسيمات الشحمية. بروتين…

إعادة بناء جسيم واحد من AcrB مضمن ...

إعادة بناء جسيم واحد من AcrB مضمن في البروتينات الشحمية. ( أ ) عرض علوي و ...

AcrB محاط بغشاء مختلف ...

يُظهر AcrB المحاط بانحناءات غشاء مختلفة بنية متطابقة. ( أ ) ثنائي الأبعاد ...


غسيل الكلى التدريجي؟ - (15 أكتوبر 2009)

أحتاج إلى بروتوكول غسيل الكلى التدريجي بالتفصيل وما هي النسبة بين العينة والعازل في هذا النوع من غسيل الكلى؟

الخطوة الحكيمة كما تقترح ، تقليل تدريجي في تركيز المكون الذي ترغب في إزالته. ماذا تريد ان تفعل؟ من المرجح أن تحصل على استجابة سريعة إذا أعطيتنا معلومات أساسية أكثر من أقل.

ساني في 18 أكتوبر 2009 ، 07 & # 5829 م قال:

أحتاج إلى القيام بذلك بعد استخلاص البروتين من أجسام متضمنة ، والآن يذوب البروتين في يوريا 8 م.
المشكلة هي أن لدي مبدأ البروتوكول ولكني لا أعرف كيف أفعل ذلك بشكل صحيح.
هذا هو البروتوكول:


((تم تعليق الحبيبة في 5 مل من اليوريا 8 م في PBS ، وطردها بالطرد المركزي كما كان من قبل والاحتفاظ بالمادة الطافية. تم تخفيف البروتين المذاب باليوريا إلى 0 2 مجم> مل مع 8 موريا في PBS وإزالة اليوريا عن طريق غسيل الكلى التدريجي مقابل 20 المجلد A يحتوي على 4 M ، 2 M ، 1 M من اليوريا ، ثم ثلاث تغييرات في المخزن المؤقت بدون اليوريا.كانت كل خطوة لغسيل الكلى لمدة ساعتين على الأقل. تم توضيح العينة بالطرد المركزي عند 70000 جم لمدة 30 دقيقة عند 4 درجات مئوية وتم غسيلها
ضد المخزن المؤقت A الذي يحتوي على 50٪ من الجلسرين لمدة 24 ساعة ويتم تخزينه عند درجة حرارة 20 درجة مئوية.)))

هذا التفصيل & # 39s عظيم. حسنًا ، 20 مجلدًا مؤقتًا هو 20 ضعف حجم العينة. قم بتكوين المخزن المؤقت الأول باستخدام 4M من اليوريا والديال في ذلك لمدة 2 ساعة. ثم انقل أنبوب غسيل الكلى إلى المخزن المؤقت الثاني المكون من 2 م يوريا وما إلى ذلك. أفضل طريقة للقيام بذلك هي تكوين المخزن المؤقت بدون اليوريا كمحلول 2x (50 ملي مولار تريس ، 20٪ جلسرين ، إلخ). ثم أضف حجمًا متساويًا من 8 م يوريا لعمل المخزن المؤقت الأول (4 م). أضف 1/4 حجم من اليوريا و 1/4 حجم ماء إلى 1/2 حجم مخزون المخزن المؤقت لجعل المخزن المؤقت لليوريا 2 مليون وما إلى ذلك وما إلى ذلك. ولكن حذر من أن البروتين قد يبدأ في الانهيار بسبب التفاعلات غير المواتية مثل اليوريا قطرات التركيز.

طريقة بديلة لإزالة اليوريا هي الحصول على حجم كبير من المخزن المؤقت في دورق. إضافة إسقاط البروتين المحوَّل الصفات إلى المخزن المؤقت. سيؤدي ذلك إلى تخفيف اليوريا بسرعة مع تقليل مخاطر البروتين: تفاعلات البروتين التي قد تؤدي إلى التراكم.

إذا كنت لا تزال تواجه مشاكل ، فانتقل إلى http://refold.med.monash.edu.au/. إنه موقع ويب مخصص لإعادة تشكيل البروتينات المشوهة ، لذا فأنت متأكد من أنك ستجد شيئًا مفيدًا.

ساني في 19 أكتوبر 2009 ، 05 & # 5821 م قال:

هذا التفصيل & # 39s عظيم. حسنًا ، 20 مجلدًا مؤقتًا هو 20 ضعف حجم العينة. قم بتكوين المخزن المؤقت الأول باستخدام 4M من اليوريا والديال في ذلك لمدة 2 ساعة. ثم انقل أنبوب غسيل الكلى إلى المخزن المؤقت الثاني المكون من 2 م يوريا وما إلى ذلك. أفضل طريقة للقيام بذلك هي تكوين المخزن المؤقت بدون اليوريا كمحلول 2x (50 ملي مولار تريس ، 20٪ جلسرين ، إلخ). ثم أضف حجمًا متساويًا من 8 م يوريا لعمل المخزن المؤقت الأول (4 م). أضف 1/4 حجم من اليوريا و 1/4 حجم ماء إلى 1/2 حجم مخزون المخزن المؤقت لجعل المخزن المؤقت لليوريا 2 مليون وما إلى ذلك وما إلى ذلك. ولكن حذر من أن البروتين قد يبدأ في الانهيار بسبب التفاعلات غير المواتية مثل اليوريا قطرات التركيز.

طريقة بديلة لإزالة اليوريا هي الحصول على حجم كبير من المخزن المؤقت في دورق. إضافة إسقاط البروتين المحوَّل الصفات إلى المخزن المؤقت. سيؤدي ذلك إلى تخفيف اليوريا بسرعة مع تقليل مخاطر البروتين: تفاعلات البروتين التي قد تؤدي إلى التراكم.

إذا كنت لا تزال تواجه مشاكل ، فانتقل إلى http://refold.med.monash.edu.au/. إنه موقع ويب مخصص لإعادة تشكيل البروتينات المشوهة ، لذا فأنت متأكد من أنك ستجد شيئًا مفيدًا.

وصف رائع أكثر مما أتوقع ، لقد وصفت كل شيء أفضل من مشرفي. شكرا جزيلا لك يا ساني ، أتمنى لك نهارا سعيدا.

مجرد سؤال آخر ، هل يمكنك توضيح ما يلي:
((هناك طريقة بديلة لإزالة اليوريا وهي الحصول على حجم كبير من المخزن المؤقت الذي يحرك في دورق. إضافة إسقاط البروتين المحوَّل الصفات إلى المخزن المؤقت.))
هل يمكنني تخزين البروتين الذائب في 8M Urea حتى تتم العملية في -80؟

لا ينبغي أن تكون هناك مشكلة. بعد al ، يتم الكشف عن البروتين بالفعل (المشكلة المعتادة عند تجميد البروتينات) ، وستقوم اليوريا أيضًا بتشويه أي بروتياز قد يكون معلقًا.

لم & # 39t تجب على سؤالي ، كيف يمكنني إضافة البروتين المشوه إلى المخزن المؤقت ، عمليًا ليس لدي أي فكرة عن هذا النوع من غسيل الكلى؟


2_أيضا هل يمكنني تشغيل SDS في هذه المرحلة للبروتين المذاب أم يجب علي إعادة طيه أولاً؟

بلوبيرد في 22 أكتوبر 2009 ، 03 & # 5811 ص قال:

mdfenko في 22 أكتوبر 2009 ، 10 & # 5806 صباحًا قال:

بلوبيرد في 22 أكتوبر 2009 ، 03 & # 5811 ص قال:


حتى لو البروتين قابل للذوبان في 8M اليوريا؟ هل تعتقد أن SDS ستعطي نتيجة جيدة.


أنواع المنظفات واختيارها

عند اختيار المنظف ، يكون الاعتبار الأول عادةً هو شكل المجموعة المحبة للماء.

بناءً على هيكلها ، يمكن تصنيف المنظفات على نطاق واسع على النحو التالي: 3

المنظفات الأيونية

تحتوي المنظفات الأيونية على مجموعات رأس أنيونية أو كاتيونية ولها شحنة صافية. ذيولها الكارهة للماء هي إما سلاسل هيدروكربونية مستقيمة ، كما هو الحال في كبريتات دوديسيل الصوديوم (SDS) وبروميد سيتيل ترايميثيل الأمونيوم (CTAB) ، أو مجموعات ستيرويدية صلبة ، كما هو الحال في أملاح حمض الصفراء. 4 يتم تحديد حجم ميسيل المنظف الأيوني من خلال التأثير المشترك للجاذبية الكارهة للماء للسلاسل الجانبية وقوى التنافر للمجموعات الأيونية. وبالتالي ، فإن تحييد الشحنة على مجموعة الرأس بتركيزات متزايدة من أيون مضاد يؤدي إلى حجم ميسيلار أكبر. يزداد حجم Micellar أيضًا مع زيادة طول سلسلة الألكيل. تعتبر المنظفات الأيونية فعالة للغاية في إذابة بروتينات الأغشية ولكنها دائمًا ما تغير طبيعة المنتج إلى حد ما. 5

أملاح حمض الصفراء هي منظفات أنيونية ذات عمود فقري تتكون من مجموعات ستيرويدية صلبة ، مثل أملاح الصوديوم لحمض الكوليك وحمض ديوكسيكوليك. نظرًا لبنيتها المستوية ، فإن هذه الجزيئات لها وجه قطبي وغير قطبي نتيجة لذلك ، فإن CMC مرتفع ومذيلاتها صغيرة ، مما يسهل إزالتها عن طريق غسيل الكلى. 6 تعد الأحماض الصفراوية منظفات معتدلة نسبيًا وغالبًا ما تكون أقل فاعلية من المنظفات ذات السلسلة الخطية مع نفس مجموعة الرأس. 7 مونومرات حمض الصفراء غير المقترنة لها قيم pKa تقارب 5-6 وقابلية ذوبان محدودة عند قيم pH منخفضة. ومع ذلك ، فإن اقتران الأحماض الصفراوية يقلل من pKa ويؤدي إلى جزء أكبر من الجزيئات المتأينة عند أي درجة حموضة معينة. نظرًا لأن شكل الملح المتأين أكثر قابلية للذوبان في الماء من شكل حمض البروتونات ، فإن الاقتران يعزز قابلية الذوبان عند درجة حموضة منخفضة. 8

منظفات غير أيونية

تحتوي المنظفات غير الأيونية على مجموعات رأس غير مشحونة ومحبة للماء تتكون إما من شقوق بولي أوكسي إيثيلين ، كما هو الحال في منظفات BRIJ ® و TRITON ™ ، أو مجموعات جليكوسيدية ، كما هو الحال في أوكتيل جلوكوزيد ودوديسيل مالتوسيد. نظرًا لأن المنظفات غير الأيونية تكسر الدهون الدهنية والبروتينات الدهنية ، ولكن لا تكسر تفاعلات البروتين والبروتين ، فإنها تعتبر غير متغيرة الطبيعة. 9 وبالتالي ، فهي تستخدم على نطاق واسع في عزل بروتينات الغشاء في شكلها النشط بيولوجيًا. على عكس المنظفات الأيونية ، فإن الأملاح لها تأثير ضئيل على حجم ميسيلار للمنظفات غير الأيونية. 5

قد تحتوي المنظفات التي تحتوي على مجموعات رأس بولي أوكسي إيثيلين على إيثرات ألكيل بولي إيثيلين بالصيغة العامة CnH2n + 1 (OCH2CH2) xOH ، أو حلقة فينيل بين سلسلة الألكيل ومجموعة الأثير. ينتمي منظف TRITON ™ X-100 إلى الفئة الأخيرة. وتجدر الإشارة إلى أن المنظفات التي تحتوي على حلقات عطرية تمتص في منطقة الأشعة فوق البنفسجية. قد تتداخل مع المراقبة الطيفية للبروتينات عند 280 نانومتر. تتوفر إصدارات مهدرجة من هذه المنظفات ، حيث يتم تقليل الحلقات العطرية للتخلص من امتصاص الأشعة فوق البنفسجية. ومع ذلك ، قد توجد كميات صغيرة من المواد غير المتفاعلة في مثل هذه المستحضرات المخفضة. بدلاً من ذلك ، يمكن استبدال منظفات البولي أوكسي إيثيلين المتاحة تجارياً مع شقوق أليفاتية كارهة للماء لبعض مركبات البولي أوكسي إيثيلين العطرية في بعض التطبيقات. على سبيل المثال ، قد يتم استبدال TERGITOL ™ 15-S-9 و TERGITOL ™ TMN-10 و polyoxyethylene 10 lauryl ether و polyoxyethylene 10 tridecyl ether بشكل عام بـ TRITON ™ X-100 في التطبيقات التي يكون فيها إخفاء الأشعة فوق البنفسجية أمرًا مهمًا. تمتلك هذه المنظفات شقوق أليفاتية كارهة للماء وبالتالي لا تمتص بشكل كبير في منطقة الأشعة فوق البنفسجية.

على الرغم من أن البولي أوكسي إيثيلين لها ميزة تكلفة كبيرة على المنظفات الاصطناعية غير الأيونية مثل ألكيل جليكوسيدات ، إلا أن الأخيرة تظل المنظفات المفضلة في العديد من التطبيقات لسببين رئيسيين. أولاً ، إنها متجانسة فيما يتعلق بتكوينها وهيكلها. ثانيًا ، يمكن تصنيع العديد من أشكال ألكيل جليكوسيدات التي تحتوي على توليفات مختلفة من سلسلة الهيدروكربون ومجموعة السكر القطبي بسهولة في أشكال نقية. يمكن استغلال الفروق الدقيقة في الخصائص الفيزيائية والكيميائية لألكيل جليكوسيدات التي تحمل سلاسل ألكيل مختلفة ، مرتبطة بمجموعة رأس الجلوكوز أو المالتوز أو السكروز ، من أجل الذوبان الانتقائي لبروتينات الغشاء. 10

منظفات زويتيريونيك

المنظفات Zwitterionic لها خصائص كلا النوعين الأيوني وغير الأيوني. مثل المنظفات غير الأيونية ، لا تمتلك مواد zwittergents صافي شحنة ، فهي تفتقر إلى الموصلية والتنقل الكهربي ، ولا ترتبط براتنجات التبادل الأيوني. ومع ذلك ، مثل المنظفات الأيونية ، فهي فعالة في كسر تفاعلات البروتين والبروتين. تعتبر مواد zwittergents القائمة على الستيرويد مثل CHAPS أقل تغييرًا للطبيعة من المنظفات zwitterionic ذات السلسلة الخطية (على سبيل المثال ، dodecyldimethyldiamine oxide). 7

كبريتات غير المنظفات

الكبريتات غير المنظفات ، NDSBs ، هي مركبات zwitterionic. مثل سلفات المنظفات (SB) - مثل SBs الخطية (على سبيل المثال ، SB 3-16 ، SB 3-10 ، 3-12 و 3-14) ، 11 CHAPS 12 ، و amidosulphobetaines (على سبيل المثال ، N-alkylamidopropyl-N ، Ndimethylaminoalkyll- sulphonate) 13 - تحمل NDSBs مجموعة الرأس sulfobetaine hydrophilic. ومع ذلك ، على عكس SBs ، فإن المجموعات الكارهة للماء في NDSBs قصيرة جدًا لتشكيل الميلي حتى بتركيزات عالية تصل إلى 1 م ، وبالتالي ، يمكن إزالة NDSBs بسهولة عن طريق غسيل الكلى ويمكنها بسهولة الانتشار في مصفوفات الكروماتوغرافيا والمواد الهلامية بولي أكريلاميد للتطبيقات الكهربية .

تم استخدام NDSBs لأول مرة في تجارب التركيز الكهروضوئية الأصلية لفحص التفاعلات الكهروستاتيكية دون زيادة الموصلية. 14 منذ ذلك الحين ، وجدوا استخدامًا في مجموعة واسعة من التطبيقات بما في ذلك إذابة البروتينات وتبلورها 14،15 ، بالإضافة إلى إعادة تشكيل وإعادة تشكيل البروتينات المحولة كيميائيًا وحراريًا. 16 نظرًا لمجموعاتها الكارهة للماء وتأثير غربلة الشحنات ، تمنع NDSBs التجميع وتؤدي إلى إنتاجية أعلى من بروتينات الغشاء. علاوة على ذلك ، لا تتداخل NDSBs مع المقايسات الأنزيمية التي تنطوي على ركائز كروموجينية تحمل مجموعات النيتروفينيل ولا تمنع أنشطة الإنزيمات مثل β-galactosidase والفوسفاتيز القلوي. 14 من الجدير بالذكر أيضًا أن NDSB-195 و NDSB-211 و NDSB-221 لا تمتص عند 280 نانومتر ، لذلك فهي متوافقة مع إجراءات تنقية البروتين التي تتم فيها مراقبة تركيزات البروتين عن طريق قياس الامتصاص عند هذا الطول الموجي. 17


ما مدى صعوبة إعادة تكوين البروتين؟ - مادة الاحياء

هناك العديد من الأسئلة المهمة التي يجب على عالم البلورات طرحها حول البروتين قبل بدء تجربة التبلور. ما هو الوزن الجزيئي للبروتين؟ في أي عازلة سيكون البروتين مستقرًا؟ هل سيبقى البروتين نشطًا إذا غليته في حمض الهيدروكلوريك المركز؟ في الأيام الأولى لعلم البلورات ، كان من الممكن توجيه هذه الأسئلة إلى عالم الكيمياء الحيوية الذي ميز البروتين بشق الأنفس بالتفصيل الكامل لسنوات عديدة قبل الدراسات الهيكلية. في الوقت الحاضر ، مع ظهور مشاريع الجينوميات الهيكلية ، قد يكون تسلسل الأحماض الأمينية هو المعلومات الوحيدة التي يجب على عالم البلورات أن يتابعها. في هذا القسم ، نستكشف عدد هذه الأسئلة المهمة التي يمكن الإجابة عليها على الإنترنت بالنظر إلى تسلسل الأحماض الأمينية فقط.

تسلسل الأحماض الأمينية للبروتيناز K من ألبوم Tritirachium

GAAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEF
EGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDN
GSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQ
SSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRSSFSNYGSVL
DIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASAC
الرياض

أجب عن الأسئلة أدناه عن طريق لصق تسلسل بروتيناز K في موقع الويب الموضح أدناه.

سؤال موقع الكتروني
ما هو الوزن الجزيئي للبروتين الخاص بي؟ غالبًا ما تحتوي البروتينات الأكبر حجمًا على مجالات مرنة متعددة تجعل من الصعب بلورة البروتين. عادة ما تكون بروتينات المجال الواحد أقل من 30 كيلو دالتون. http://ca.expasy.org/tools/protparam.html
كم عدد الأحماض الأمينية في البروتين؟ كم عدد الميثيونين؟ بشكل عام ، سيضمن أكثر من ميثيونين واحد لكل 100 حمض أميني نجاح تجربة selenomet MAD. http://ca.expasy.org/tools/protparam.html
هل هناك أي بقايا من التربتوفان في تسلسل البروتين؟ التربتوفان هي نقاط مرجعية جيدة لتعيين التسلسل لخرائط كثافة الإلكترون بسبب حجمها الكبير وشكلها المميز. ولكن الأهم من ذلك ، أن فترة ما قبل التريبتوفان تمنح معامل انقراض كبير عند 280 نانومتر من الطول الموجي الذي يسهل تحديد تركيز البروتين عن طريق القياس الطيفي. (يساهم كل من Tyr و Phe و disulfides أيضًا في مكون ثانوي في معامل الانقراض ، ولكن في حالة عدم وجود التربتوفان ، قد لا تكون مساهمتهم كافية للسماح بتحديد طيفي دقيق لتركيز البروتين). http://ca.expasy.org/tools/protparam.html
ما هو معامل الانقراض عند 280 نانومتر؟ رقم قيم لتحديد تركيز البروتين عن طريق القياس الطيفي. تعتبر اختبارات Biuret أو BioRad طرقًا بديلة لتحديد تركيز البروتين ، ولكنها تستغرق وقتًا أطول. http://ca.expasy.org/tools/protparam.html
هل هناك أي بقايا سيستين حرة؟ تتفاعل السيستين مع الزئبق وأيونات المعادن الثقيلة الأخرى من الفئة ب. يشير وجودها إلى أنه يمكن استخدام الزئبق كمشتق للتشغيل التدريجي. يجب على المرء أيضًا أن يفكر في الموقع الخلوي للبروتين. إذا كان خارج الخلية ، يمكن أن تتأكسد السيستين في رابطة ثاني كبريتيد ، مما يقلل من تفاعل السيستين تجاه الذرات الثقيلة. http://ca.expasy.org/tools/protparam.html
ما هو pI للبروتين الخاص بي؟ سيحدد pI الطريقة التي سينتقل بها البروتين في مجال كهربائي في اختبار تغيير نطاق الهلام الأصلي لمشتقات الذرة الثقيلة المحتملة. أيضًا ، إذا كان البروتين غير قابل للذوبان عند التركيز ، يجب على المرء أن يفكر في استخدام مخزن مؤقت بعيدًا عن pI. http://ca.expasy.org/tools/protparam.html
هل هناك أي متماثلات للبروتين الخاص بي؟ ما هي وظائفهم؟ سيسمح التماثل الوثيق في PDB (أفضل من تشابه التسلسل بنسبة 30 ٪) بالتدرج عن طريق الاستبدال الجزيئي. أيضًا ، يمكن استخدام المعرفة بالكيمياء الحيوية للمتماثل لملء الفجوات في المعرفة حول بروتين الموضوع إذا لم تتم دراسته جيدًا. http://www.ncbi.nlm.nih.gov/BLAST/ (استخدم blastp)
هل هناك أي روابط يمكنني تعقيدها مع البروتين الخاص بي للمساعدة في استقرار مرونة البروتين المطابقة؟ كلما زادت صلابة البروتين ، زادت احتمالية تبلوره. علاوة على ذلك ، فإن المركب الذي يحتوي على نظير ركيزة أو ركيزة هو بطبيعته أكثر إثارة للاهتمام وكشفًا من الناحية العلمية. إذا كان هناك أدبيات موجودة للبروتين الخاص بك ، فيمكنك البحث عنه عن طريق الكلمات الرئيسية على PUBMED. إذا لم يكن هناك أي كتاب عن البروتين الخاص بك ، يمكنك البحث عن أدبيات حول المتماثل الذي اكتشفته في بحث الانفجار أعلاه. http://www.ncbi.nlm.nih.gov/entrez/query.fcgi؟db=PubMed
ما هو التنبؤ بالهيكل الثانوي للبروتين الخاص بي؟ من المفيد معرفة التنبؤ بالهيكل الثانوي عندما تحكم على جودة أول خريطة تجريبية لكثافة الإلكترون. إذا كان التوقع يقترح جميع اللوالب ولا يمكنك العثور على حلزون واحد في الخريطة ، فربما تشكك في جودة خريطتك؟ http://bioinf.cs.ucl.ac.uk/psipred/psiform.html
العديد من الخيارات الأخرى المدرجة من قبل موقع ويب expasy.
(2) تركيز البروتين الخاص بك

مصممو البلورات هم الخبراء في تركيز البروتين. تتطلب القليل من التجارب الأخرى في الكيمياء الحيوية تركيزات عالية من البروتين النقي مثل تجارب التبلور. يتطلب التبلور عادةً تركيز 10 مجم / مل للبروتينات في نطاق 10-30 كيلو دالتون. يتطلب البروتين الأكبر تركيزًا أقل (2-5 مجم / مل). تميل البروتينات الأصغر إلى طلب تركيز أعلى (20-50 مجم / مل). هناك مجموعة أدوات متاحة لمساعدتك في اختبار ما إذا كان البروتين الخاص بك في تركيز مناسب لتجارب التبلور الأولية. يحتوي على العديد من عوامل الترسيب التي يشيع استخدامها في التبلور. إذا وجدت عند إضافة هذه العوامل إلى 3 ميكرولتر من البروتين الخاص بك تكوين ترسيب ، فمن المحتمل أن يكون تركيز البروتين مناسبًا لتجارب التبلور. للحصول على مجموعة Crystool Pre-Screen Kit (مجانًا؟) ، أرسل بريدًا إلكترونيًا إلى Bernhard Rupp.

أقوم عادةً بتركيز البروتين باستخدام مُكثّف Centricon من Amicon. تم تصميم المركز لاستخدام قوة الطرد المركزي لدفع المذيب من خلال المسام الموجودة في الغشاء ، بينما يحتفظ البروتين بالداخل من خلال استبعاد الحجم. يحمل المركز حتى 2.5 مل ويتركز إلى ما لا يقل عن 100 ميكرولتر في دوار SS34. يتطلب التركيز حوالي ساعتين عند 5000 دورة في الدقيقة.

تحقق دائمًا من تركيز البروتين قبل استخدام سنتريكون. لا يتم ضمان التعافي الجيد من المركز دائمًا في البداية ، لذلك تريد أن تكون قادرًا على التحقق من حصولك على نفس الكمية من البروتين من المركز الذي تضعه. يعتمد الاسترداد الجيد على اختيار قطع الوزن الجزيئي الصحيح (MWCO) ) ، والمخزن المؤقت المناسب: هناك MWCOs مختلفة (3kDa ، 10kDa ، 30kDa) لبروتينات مختلفة الحجم. كلما زاد حجم MWCO ، زادت سرعة عملية التركيز. احرص على اختيار MWCO أصغر بكثير من الوزن الجزيئي للبروتين. خلاف ذلك ، قد ينحصر البروتين في مسام الغشاء. من الجيد أيضًا تضمين 10 ملي كلوريد الصوديوم على الأقل لمنع البروتين من الالتصاق بسطح الغشاء. إذا كانت القوة الأيونية منخفضة للغاية ، فإن الأجزاء الكارهة للماء من البروتين على سطح الغشاء تسد المسام وتبطئ عملية التركيز. عندما تحدث هذه الظاهرة ، يمكنك أيضًا تقليل محصول استعادة البروتين بشكل كبير.

يمكن أن يكون تحقيق تركيز بروتين كافٍ مع الحفاظ على الذوبان مشكلة صعبة لبعض البروتينات. قد تجد أن البروتين الخاص بك "نفد" من المحلول. (على سبيل المثال ، يمكنك العثور على هلام صافٍ في قاع أنبوب الاسترداد المركزي). أو ربما يترسب في كعكة بيضاء ناعمة. تحدث هذه الأشياء لأن البروتين يفضل التفاعل مع جزيء بروتين آخر بدلاً من تفاعل جزيئات المذيبات. يكمن حل "اللامحلول" عادةً في إيجاد درجة الحموضة العازلة الصحيحة أو المضافات الكيميائية. قم بتغيير الرقم الهيدروجيني للعازل بعيدًا عن pI للبروتين من أجل زيادة الشحنة على البروتين وتفضيل تفاعله مع المذيب. أيضًا ، غالبًا ما تؤدي إضافة الجزيئات العضوية القطبية الصغيرة مثل الجلسرين أو السكروز أو ميثيل بنتانيديول أو 1.6-هيكسانديول إلى إذابة زيوت البروتين على الفور. إذا كنت تعلم أن البروتين الخاص بك يستخدم أيونات معدنية ، أو يربط ليجند ، فإن إضافة هذه المواد الكيميائية يمكن أن تحسن أيضًا من قابلية ذوبان البروتين. في الحالات الصعبة للغاية ، يمكنك استخدام منظف معتدل مثل بيتا أوكتيل جلوكوزيد. طريقة مناسبة لاختبار المركبات المختلفة لتأثيرها على الذوبان على البروتين هي أخذ قطرة من زيت البروتين أو ترسبها على غطاء زجاجي وإضافة بعض المواد الكيميائية إليها أثناء مشاهدة القطرة في المجهر. إذا تذوب الزيت أو الراسب ، يمكنك إضافة تلك المادة الكيميائية إلى مخزون البروتين قبل التركيز للحفاظ على قابلية الذوبان.

(3) شرح طريقة التبلور المعلقة لنشر بخار القطرات

تعد تقنية انتشار بخار القطرات المعلقة هي الطريقة الأكثر شيوعًا لتسخين الجزيئات الكبيرة. مبدأ انتشار البخار واضح ومباشر. يتم وضع قطرة مكونة من خليط من العينة والكاشف في موازنة بخار مع خزان سائل من الكاشف. عادةً ما تحتوي القطرة على تركيز كاشف أقل من الخزان. لتحقيق التوازن ، يترك بخار الماء القطرة وينتهي في النهاية في الخزان. عندما يترك الماء القطرة ، تخضع العينة لزيادة التشبع الفائق النسبي. تزداد كل من العينة والكاشف في التركيز حيث يترك الماء القطرة للخزان. يتم الوصول إلى الموازنة عندما يكون تركيز الكاشف في القطرة هو نفسه تقريبًا الموجود في الخزان.


ما هو الجين؟

يمكن أن يختلف تعريف الجين اعتمادًا على من تسأل. أصبح الجين العالمي حرفياً رمزًا ثقافيًا في يومنا هذا. هل يمكن لجيناتنا أن تشرح ما معنى أن تكون إنسانًا؟ لقد تغير تعريف الجين بمرور الوقت.

الشكل: عرض للجينات ومنتجاتها: من البساطة إلى التعقيد

تحتوي جينات حقيقيات النوى على exons (مناطق ترميز) وإنترونات (تسلسلات متداخلة) يتم نسخها لإنتاج نسخة أولية. في عملية ما بعد النسخ ، يتم تقطيع الإنترونات من خلال الانقسام ، لإنتاج مرسال RNA ، mRNA ، والذي يُترجم إلى تسلسل بروتين. (انظر الرسم البياني أعلاه).

على مدى المائة عام الماضية ، مع زيادة فهمنا للكيمياء الحيوية ، تطور تعريف الجين من

  • أساس الصفات الموروثة
  • مناطق معينة من الكروموسومات
  • قطعة من الكروموسوم تنتج إنزيمًا واحدًا
  • قطعة من الكروموسوم تنتج بروتينًا واحدًا
  • جزء من الكروموسوم ينتج منتجًا وظيفيًا

كان التعريف الأخير ضروريًا لأن بعض المنتجات الجينية التي لها وظيفة (هيكلية وحفازة) هي جزيئات RNA. يشمل التعريف الأخير أيضًا المناطق التنظيمية للكروموسوم المتورط في التحكم في النسخ. طور سنايدر وجيرستين خمسة معايير يمكن استخدامها في تحديد الجينات وهو أمر مهم حيث يتم تحليل الجينومات الكاملة للكائنات بحثًا عن الجينات.

  1. تحديد إطار القراءة المفتوح (ORF) - سيشمل ذلك سلسلة من الكودونات المرتبطة برموز البدء والإيقاف. يصبح هذا الأمر أكثر صعوبة بشكل تدريجي إذا كان الجين يحتوي على عدد كبير من exons مضمنة في الإنترونات الطويلة.
  2. specific DNA features within genes - these would include a bias towards certain codons found in genes or splice sites (to remove intron RNA)
  3. comparing putative gene sequences for homology with known genes from different organisms, but avoiding sequences that might be conserved regulatory regions.
  4. identification of RNA transcripts or expressed protein (which does not require DNA sequence analysis as the top three steps do) -
  5. inactivating (chemically or through specific mutagenesis) a gene product (RNA or protein).

New findings make it even more complicated to define a gene, especially if the transcripts of a "gene region" are studied. Cheng et al studied all transcripts from 10 different human chromosomes and 8 different cell lines. They found a large number of different transcripts, many of which overlapped. Splicing often occur between nonadjacent introns. Transcripts were found from both strands and were from regions containing introns and exons. Other studies found up to 5% of transcripts continued through the end of "gene" into other genes. 63% of the entire mouse genome, which is comprised of only 2% exons, is transcribed.


SUWA: A hyperstable artificial protein that does not denature in high temperatures above 100C

The Onbashira Matsuri is a festival where men climb on and slide down a mountain side on large timber logs, a holy tradition dating back 1,200 years. The lumber is then used to build the one of the main shrines of Japan, the Suwa Taisha. Credit: ©2012-2014 Suwa Tourism Association

Proteins denature, or "cook" in heat, irreversibly changing their structure, like how an egg boils or a slab of sirloin turns to steak. This prevents proteins from being used in applications where they would need to withstand heat. Scientists have had high expectations for proteins to be used in nanotechnology and synthetic biology. A new hyperstable artificial protein constructed at Shinshu University in collaboration with Princeton University hopes to make some of those aspirations possible with the successful development of SUWA (Super WA20), a nanobuilding block in the shape of a pillar, so-called in honor of the Onbashira Matsuri, also known as "the pillar" festival where men climb on and slide down a mountain side on large timber logs, a holy tradition dating back 1,200 years. The lumber is then used to build one of the main shrines of Japan, the Suwa Taisha. The hope is that these SUWA nano-pillars will go on to build things just as central to society.

  • A de novo protein SUWA (Super WA20) is significantly more stable than its predecessor WA20.
  • SUWA did not boil at 100 °C, while WA20 denatures at 75 °C. The denaturation midpoint temperature of SUWA protein was found to be 122 °C. This is an ultra-stabilized artificial protein.
  • The characteristic three-dimensional structure of the dimer with a bisecting U topology of SUWA was elucidated by X-ray crystallography.
  • Molecular dynamics simulation suggests that the stabilization of the center of the α-helices contributes to the structural stabilization and high heat resistance in SUWA.
  • Protein nanobuilding blocks using SUWA, nanoscale pillars "nano-onbashira" are expected to be applied to nanotechnology and synthetic biology research in the near future.

Proteins and self-assembling protein complexes perform functions inside the living body like nanomachines making them a key component in the complex phenomena of life. Artificial design of proteins with desired functions would have many applications in biopharmacy and provide chemical reactions with low environmental impact. This nanotechnology is in the scale of molecules, 1/1,000,000 of a millimeter, making them difficult to work with, but have many promising applications.

The ratio of denatured proteins with temperature. Credit: © 2020, American Chemical Society

A research group led by Ryoichi Arai of Shinshu University and Michael H. Hecht of Princeton University solved the crystal structure of the de novo protein WA20 in 2012. This current research builds upon the WA20 structure, to make the Super WA20—aka SUWA—recently explored in the paper published in the February issue of ACS Synthetic Biology, an American Chemical Society academic journal.

Associate Professor Ryoichi Arai of Shinshu University Interdisciplinary Cluster of Cutting Edge Research's Institute for Biomedical Sciences and Naoya Kimura, a graduate of the Faculty of Textile Science and Technology of Shinshu University were central figures behind this new development of SUWA, a hyperstable artificial protein.

The Onbashira Matsuri is a festival where men climb on and slide down a mountain side on large timber logs, a holy tradition dating back 1,200 years. The lumber is then used to build the one of the main shrines of Japan, the Suwa Taisha. Credit: ©2012-2014 Suwa Tourism Association

The naming of SUWA is derived from the location of the Onbashira Matsuri, which takes place in the Suwa region of Nagano Prefecture. Nagano is where Shinshu University holds its five campuses.


HSC Biology Concept 6: Antigens and Organ Transplants

Your organs have antigens on their surface. Your immune system recognises these as part of your body and doesn’t launch an immune response against them.

However, organs or parts of organs can be transplanted from the body of a donor into the body of a صبور.

The donated organ will have surface antigens unique to the donor and so the patient’s body recognises these as foreign. The immune system will attack these foreign cells and try to destroy the donated organ.

The patient is given immune suppressants to stop the body from attacking the donated organ, but this leaves the patient more susceptible to actual pathogens that cause illness. The patient will have to remain on immune suppressants for the rest of their life.


شاهد الفيديو: أسرار لعبة كمال الاجسام وازاي تبني عضلات ب طريقة صح المنشطات والبروتين شيك ايه فوايدهم (يوليو 2022).


تعليقات:

  1. Aethelmaer

    هذه حقا مهزلة ، نوع من

  2. Braxton

    وأنا أعتبر أن كنت ارتكاب الخطأ. دعونا نناقشها.

  3. Lindleigh

    مدونة جميلة ، لكنها تستحق إضافة المزيد من المعلومات



اكتب رسالة