معلومة

كيف يمكن التوفيق بين تسلسلات هياكل PDB عبر مراجع Uniprot؟

كيف يمكن التوفيق بين تسلسلات هياكل PDB عبر مراجع Uniprot؟


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

أحاول التوفيق بين الهياكل في إدخالات PDB مع تسلسلها كما ورد في ملفاتchemList.polymer.dbrefإدخالات.

على سبيل المثال: النظر في هياكل تكامل فيروس نقص المناعة البشرية:

PDB: 3OS0المراجعUNP: P14350، مع التركيز على Integrase (len = 391)

> sp | P14350 | 752-1143 CNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVKVSRPEGVKIIPPQSDRQKIVLQ… NRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE

PDB: 2B4JالمراجعUNP: P12497، مع التركيز على Integrase (len = 287)

> sp | P12497 | 1148-1435 FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI… LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDCVASRQDED

لماذا يجب أن تكون هذه التسلسلات مختلفة جدًا ؟!

وفي حال كنت تعتقد أنني أركز على القليل من الضوضاء: هناك 42 أخرى هياكل تكامل فيروس نقص المناعة البشرية كل الرجوعUNP: P14350، و 43 آخر مرجع الهياكلUNP: 12497(و 79 آخرين يشيرونUNP: Q76353، تشبه الى حد بعيدUNP: 12497) ، 22 تشير إلى ملف مختلف تمامًاUNP: Q72498.


لا أحد منهم هو عبارة عن مجموعة متكاملة:

P12497 بروتين Gag-Pol polyprotein Gene gag-pol كائن حي فيروس نقص المناعة البشرية من النوع 1 المجموعة M النوع الفرعي B (عزل NY5) (HIV-1)
P14350 بروتين Pro-Pol polyprotein Gene pol كائن حي فيروس spumaretrovirus البشري (SFVcpz (hu)) (فيروس رغوي بشري)

حتى لو كنت تقصد منتج متكامل للبروتين ، فإن المنتج الثاني ليس حتى فيروس نقص المناعة البشرية.

من ويكيبيديا:

فيروس الرغوة البشرية (HFV) هو فيروس ارتجاعي وينتمي على وجه التحديد إلى جنس Spumavirus. تعد فيروسات السبوما معقدة وتختلف اختلافًا كبيرًا عن الأنواع الستة الأخرى من الفيروسات القهقرية من نواحٍ عديدة. تشتق الفيروسات الرغوية اسمها من المظهر "الرغوي" المميز لتأثير الاعتلال الخلوي (CPE) المستحث في الخلايا.[1]


شاهد الفيديو: How to get a protein PDB file from protein data bank? (يوليو 2022).


تعليقات:

  1. Gogu

    أقترح عليك أن تأتي على موقع يوجد فيه الكثير من المعلومات حول هذا السؤال.

  2. Gardatilar

    أنا آسف ، لكنني أعتقد أنك مخطئ. أنا متأكد. أقترح مناقشته.

  3. Mell

    حق تماما! ويبدو لي أنها فكرة ممتازة جدا. تماما معك سوف أوافق.



اكتب رسالة